Sentence examples for work was synthesized from inspiring English sources

The material studied in this work was synthesized by mixing commercial graphite powder with the crosslinked polysilazane VL20®.

The graphene nanosheets used in this work was synthesized by electrochemical exfoliation, whereas TiO2 nanoparticles by using the co-precipitation method.

The nanocomposite used in this work was synthesized using nano fly ash and acrylamide by free radical polymerization and hydrogel was prepared by crosslinking a fly ash-polyacrylamide nanocomposite with chromium acetate.

The triazoloacridone compound C-1305 used in this work was synthesized at the Department of Pharmaceutical Technology and Biochemistry (Gdańsk University of Technology) by Dr. Barbara Horowska.

Graphene used throughout this work was synthesized through chemical vapor deposition (CVD) of methane on copper foil at 1020 °C substrate temperature with an ensuing wet transfer procedure to supporting quartz glass.

All peptides used in this work were synthesized utilizing standard Fmoc solid-phase peptide chemistry on an AAPPTec Focus peptide synthesizer.

The results of our work are synthesized to create actionable insights and tools for decision-makers.

Both the n-type NWs [20 22] and the graphene [23] used in this work were synthesized via the CVD method.

If the use of a person's name or likeness is only "one of the 'raw materials' from which an original work is synthesized," then the 1st Amendment shields the creators from right-of-publicity claims.

The high quality peptides used in this work were synthesized by Biopeptide Co., San Diego, USA, with the exception of LL-37 ([LL-37, 37 aa]), which was obtained from Innovagen AB, Lund, Sweden.

Finally, the contributions and implications of this work are synthesized.