Sentence examples for which causes a frame from inspiring English sources

When activated, it catalyzes the splicing of Xbp1 mRNA, which causes a frame shift during Xbp1 translation.

In addition, we found another variant lacking the region encoded by exons 5 and 6, which causes a frame shift, resulting in a stop codon in the region encoded by exon 7. hNETΔEX6 mRNA was also detected in the adrenals and fetal brain but not in the adult brain, suggesting a tissue-specific and development-dependent splicing of hNET transcripts.

Sequence analysis of genomic DNA from wild-type and albino cats identified a cytosine deletion in TYR at position 975 in exon 2, which causes a frame shift resulting in a premature stop codon nine residues downstream from the mutation.

Later, another Pakistani family showed the deletion of four consecutive nucleotides (TCAG) in the 11th exon of the CENPJ gene, which causes a frame shift and a premature termination codon 19 bp downstream in the same exon that is predicted to add six amino acids downstream of the mutation [ 60].

The KIR2DS4-deleted variant differs from the normal KIR2DS4 gene sequence by a 22 bp deletion in exon 5, which causes a frame shift, yielding a truncated KIR2DS4 protein with loss of the transmembrane and cytoplasmic domains of the full-length KIR2DS4 protein [ 27].

Since the deletion in gli2a i275 results in the loss of just four residues QLLS283-286, in a region that is not highly conserved between Gli proteins, we focused on the gli2a i276 the insertion in which causes a frame shift resulting in a premature stop codon at CDS-1167 (supplematerialmaterial Fig. S2A).

The deletion of c.1934G c.1934delGG), which causes a frame-shift (Gly645ValfsX58), occurs in 5 of 11 CRC cell lines with MSI, whereas the duplication of c.1934G (c.1934dupG), which causes a frame-shift (Gly646TrpfsX12), occurs in 1 of 11 CRC cell lines with MSI.

Targeted re-sequencing in the vicinity of CG2943 revealed that 655G has a two-base deletion at 3R 3729838-3729839 which causes a frame-shift mutation of CG2943, causing185aa deletion from I730 to C-terminus adding polypeptide of RTVRGQESGKQQCLEFLASSANAPRGAPVLYTAHNS.

As a result of DNA sequencing of purified B cells, we found one nucleotide deletion mutation, which caused a frame shift after the amino-acid residue 251, in half of the DNA.

All final MA lines but line p20 had the mutS insertion, which causes a reading frame shift and premature translation termination.

crtS gene sequences from strains VKPM Y2410, ATCC 24203, ATCC 96594, and ATCC 96815 show several nucleotide changes, but none of them causes any amino acid substitution, except a G2268 insertion in the 13th exon of ATCC 96815 which causes a change in the reading frame.