Sentence examples for used as established from inspiring English sources

When a study described multiple cut-off levels, the level corresponding to the most used cut-off among other included studies was used, as established after collecting all data.

A variant of green fluorescent protein (GFPuv) from Aequorea victoria was used as a reporter to establish the methodology.

In pharmaceutical modelling, cellular automata have been used as an established tool to represent molecular changes through discrete structural interactions.

[Lys40(Ahx-DTPA NH2]-exendin-4 Ahx-DTPA NH2]-exendin-4IEWLKNGGPSSGAhx-DTPA NH2]-exendin-4nd Ahx-DTPA NH2]-exendin-4(HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSK DTPA-Ahx -NH2yntHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSK DTPA-Ahx -NH2 already establisHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSK DTPA-Ahx -NH2

The software is now used as an established railway simulation tool in the railway industries, consultancies and universities in many different countries [27].

SH-SY5Y cells treated with MMP+ at 1000  μM for 24 h were used as the established PD model.

Severity is a familiar concept in routine PHC work and is used as an established criterion for priority setting also in other countries [ 16, 17].

Flecainide is used as an established test to unmask the arrhythmogenic phenotype in BrS patients (46), while quinidine has been shown to have therapeutic effects in BrS (2).

NHAC-kn were derived from a single-donor knee articular cartilage and used as an established normal chondrocyte cell line [ 27, 28].

For interpreting clinically important differences on the PHC and MHC of the RAND-12, Cohen's guidelines for effect sizes were used as no established guidelines were available.

Myelin basic protein (MBP) was used as an established in vitro substrate protein of HIPK2 [ 7], and we also employed a peptide originally developed as a substrate for DYRK1A [ 38].