Your English writing platform
Discover LudwigExact(2)
The host organisations are given technical and financial support for three years after the centre opening, but their long-term impact rests upon successful integration into the local communities.
Upon successful integration of the CSΔN construct, the wild-type copy of CSP is replaced by a truncated version lacking the amino acids NKSIQAQRNLNELCYNEGNDNKLYHVLNSKNGKIYNRNTVNRLLADAPEGKKNEK KNEKIERNNKLKQP, which encompass the entire N-terminal region, except for the signal sequence.
Similar(58)
"It's our most successful integration".
"I will continue working until my successor is appointed to ensure the successful integration".
And it shows complete disdain for the real needs of successful integration.
In October, Belgium resettled one detainee, whose successful integration should be reassuring to Belgian officials.
The country's state secretary for integration issues, Maria Böhmer, said successful integration could not be compared to assimilation.
District after district modelled its integration plans on Charlotte, and the city was lauded as an example of what successful integration could look like.
He all but ignores the multiple examples of upward mobility and successful integration.
The picture is not uniform — successful integration exists — but it is troubling.
Successful integration would save automakers from making costly hardware upgrades.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com