Your English writing platform
Discover LudwigExact(59)
In the Standard Model, if all of those contributions were taken seriously and added up, the theoretical mass of the Higgs would explode beyond any reasonable value.
For decades, he explains, astronomers have been arguing about the theoretical mass limit of stars.
Figure 11 The process of calculation of the final theoretical mass of the substances.
We compare the theoretical mass of each FT node with the observed mass of the peak.
Let (mu (f)) denote the theoretical mass of the molecular formula f (either fragment or loss).
The measured mass was m/z 283.0579 with a 2.7 mDa error off the theoretical mass 283.0606.
However the theoretical mass required was two orders of magnitude greater than what was available in the Southwest Pacific.
Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.
The cut-off for mass differences with the theoretical mass of the identified peptides was set at 2 ppm.
A total of 43 out of 128 peptides from trypsinized p170 matched the theoretical mass values of A2ML1 tryptic peptides.
This value was in accord with the theoretical mass of the predicted human RFRP-1 (MPHSFANLPLRF-NH2) [1428.75 m/z ([M+H]+)].
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com