Sentence examples for synthesizer model from inspiring English sources

The oligonucleotide primers were synthesized in an automated Applied Biosystems DNA synthesizer (Model 381A; Applied Bio-systems, Foster City, CA, USA) using the phosphoramidite method and purified in high performance liquid chromatography (HPLC).

The primers were synthesized in our laboratory using a DNA/RNA Synthesizer, Model 392 (Applied Biosystems).

Mouse Aβ1-42, DAEFGLMVGGVVIAQKLVFFAEDVGSNKGAII GLMVGGVVIA was synthesized using Fmoc chemistry on an automated peptide synthesizer (model PS3, Protein Technologies, USA).

Peptides MIASHLLAYFFTELNβA-GYGRKKRRQRRRG (TAT-HK) and GYGRKKRRQRRRG-βA-EEEAKNAAAKLAVEILNKEKK (TAT-Ctr) were synthesized by a solid phase method using an automatized peptide synthesizer (model 431-A, Applied Biosystems, Foster City, CA).

Peptides MIASHLLAYFFTELNbA-GYGRKKRRQRRRG (TAT-HK) and GYGRKKRRQRRRG-bA-EEEAKNAAAKLAVEILNKEKK (TAT-Ctr) were synthesized as described [27] by a solid phase method using an automatized peptide synthesizer (model 431-A, Applied Biosystems, Foster City, CA) and the fluoren-9-ylmethoxycarbonyl (Fmoc) strategy.

VP1211 225 (peptide sequences: FGEHKQEKDLEYGAC) and VP2136 150 (peptide sequences: AGGTGTEDSHPPYKQ) were synthesized in-house by solid phase method using an automated multichannel parallel peptide synthesizer (model Prelude from Protein Technologies, Inc ., employing the fluorenylmethoxycarbonyl (Fmoc) group for α-amino group protection.

Robert Bobb" Moog was born in New York City on May 23 , 1934 and developed his classic synthesizer models in the late 60s and early 70s.

Peptides FGWALP23, FGWALP23, YGWALP23, and WGWALP23 (Table 1) were synthesized on a model 433A synthesizer from Applied Biosystems by Life Technologies (Foster City, CA) using solid-phase methods, as described previously.

GLP-1C (7−37C, Figure 1a) with an additional cysteine residue added to the C-terminus of the GLP-1 (3−37) peptide sequence was synthesized via a solid-phase peptide synthesizer (SPPS, Applied Biosystems, Model 433A).

Thymosin β4 was chemically synthesized on a model 431A peptide synthesizer using solid phase Fmoc chemistry.

Extra points given to PSB for using old model synthesizers that sounded better than ever.