Sentence examples for specifies the region from inspiring English sources

The notice2d command specifies the region of 2D data to be included in the analysis.

The notice2d_id command specifies the region of 2D data to be included in the analysis.

This specifies the region of the SV40 DNA molecule which induces the early SV40 antigens: U antigen, tumor specific transplantation antigen, and T antigen.

The output of tg_create_mask is a FITS region file which enumerates the grating parts and specifies the region shape, size, and orientation in sky pixel-plane coordinates.

This specifies the region on the detector with pixel coordinates (X,Y) satisfying the conditions x0<=X<=x1 and y0<=Y<=y1, and indicates that the region is to be regridded to nx by ny pixels in the output image.

Furthermore, Fig. 4 specifies the region in which cooperative advertising program makes partial information sharing better than no information sharing for the manufacturer and retailer 1.

Synthetic peptides (1 30 EVTSDQVANVMWDYFTQLSNNAKEAVEQLQ, 1 15 EVTSDQVANVMWDYF and 17 30 QLSNNAKEAVEQLQ) were used to specify the region in between residues 1 and 30.

Not only do we need to generate the algebraic expression, but we also have to be careful to specify the region of convergence over which that algebraic expression is valid.

Step 5 Let φ f,p specify the region of the pixels of packet p of frame f.

The user can specify the region to display in one of three ways: (i) an index SNP and a window size, (ii) the chromosome together with start and stop positions or (iii) gene name and size of flanking region.

A simple plot can be generated from the web form by uploading a file with SNP names and P-values, and specifying the region to be plotted and optional features using drop-down buttons.