Sentence examples for sequence of strains from inspiring English sources

Genome location plots were produced using BRIG V.0.9556 with the genome sequence of strains 19A (NC_010380.1), D39 (NC_008533.1) or R6 (NC_003098.1) as references (Figs 1, S5 and S6, respectively).

First, our DNA microarray was based on the genome sequence of strains NCTC 11168 and RM1221, and genes that are not present in these strains used to construct the microarray will not be detected.

Sequences containing the fit genes were aligned to the reference sequence of strains Pf-5 and 30-84 [ 16, 17].

In contrast, the VP7 sequence of strains representing each electropherotype and P-type were closely related, sharing >99% nucleotide identity.

In order to characterise new bacteriocins produced by Streptococcus mutans we perform a complete bioinformatic analyses by scanning the genome sequence of strains UA159 and NN2025.

From highest to lowest mean rates, the sequence of strains was: XXX, E. coli, VOT, VXT, heat-killed VOT, heat-killed E. coli, VXX (for significant and non-significant differences between these responses, see Fig.  4b).

Likewise, the identified nucleotide changes in the 10 J166output strains were validated by aligning the individual sequencing reads against the completed reference genome sequence of strain J166.

The synthetic V3 loop peptide represented the V3 sequence of strain IIIB (amino acids AA 297 330; numbering according to reference 44, TRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAH.

The genome sequence of strain PD-2 was sequenced and analyzed by Majorbio Co., Ltd.

A phylogenetic tree was created with the gene sequence of strain CCG1 and with their similar sequences of reference strain which are obtained from NCBI database.

Partial dnaK gene sequence of strain MW9T was identical to MW10, MW11, MW12, MW13 and MW14 gene sequences.