Sentence examples for proceed with generating from inspiring English sources

Exact(1)

Following our proposed schema, we proceed with generating a classification and regressing tree using Weka's decision tree builder as shown in Fig. 6.

Similar(59)

Now Barrick has said the discussions have ended, and price appears to be the issue: [We] will only proceed with opportunities that generate acceptable value for Barrick.

The organization, made up of the United States, South Korea, Japan and the European Union, must also decide early this year whether to proceed with plans to help North Korea generate energy by building two light-water nuclear reactors whose spent fuel cannot easily be converted into bombs.

Or vice versa, the orientation parameters or epipolar images can be generated to proceed with an alternative dense image matcher.

In brief, ELISA IgG titers measured using heterologous ES2 protein or (EQELLELDKWASLWNWFDITKWLWYIKKKKGSKKK) gp41 MPER peptide were used to determine mice that were to be sacrificed to proceed with fusion of splenocytes to generate hybridoma cells.

Scientists in Britain also have received approval to proceed with therapeutic cloning, the idea of generating healthy replacements for diseased tissues from embryonic cells derived from the patient's own mature cells.

How can he expect them, faced with such a threat, to proceed with the massive investment Britain needs in new generating capacity?

However, the advantages of being able to map to an annotated genome and thus determine how many small RNAs map to protein coding genes (and whether they map sense or antisense) and to intergenic regions were significant enough that we proceeded with the data generated by aligning the E. histolytica Rahman small RNA library to the E. histolytica HM-1 IMSS HM-1 IMSSquence.

remained committed to investing in nuclear power despite events in Japan and would proceed with plans to build four nuclear reactors to generate power in coming years.

Based on the generated hot water profiles, we can now proceed with calculating loads associated with household hot water usages.

It would proceed with the careful marshaling of evidence that capitalism can be ethically beneficient — that, for example, markets generate trust.

Show more...

Ludwig, your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: