predicted to release

USAGE SUMMARY

The phrase "predicted to release" is correct and usable in written English.
It can be used when discussing something that is expected to be made available or launched in the future, such as a product, movie, or software. Example: "The new smartphone model is predicted to release in the spring of next year."

✓ Grammatically correct

Science

News & Media

Human-verified examples from authoritative sources

Exact Expressions

8 human-written examples

By sequence comparison and signal peptide prediction, the precursor was predicted to release a 55-amino acid mature peptide with amino acid sequence, IRCPKDKIYKFCGSPCPPSCKDLTPNCIAVCKKGCFCRDGTVDNNHGKCVKKENC.

Natural Products and Bioprospecting

A 1 1 molar ratio mixture of MgH2 and LiNH2 was predicted to release 8.1 wt.% H under moderate conditions.

Acta Materialia

Peptide GPSMR was predicted to release a dipeptide ACE inhibitor, GP, from its precursor after gastrointestinal digestion.

BMC Complementary and Alternative Medicine

The presence of a deletion in PTEN in this ampullary cancer would be predicted to release from inhibition activation of the PI3K/mTOR pathway.

Genome Medicine

The pentapeptide, GPSMR, was hydrolysed after digestion and it was predicted to release a dipeptide ACE inhibitor, GP, from its precursor.

BMC Complementary and Alternative Medicine

According to the database, GPSMR was predicted to release fragments of GP, SM and R from its precursor after gastrointestinal digestion.

BMC Complementary and Alternative Medicine

Human-verified similar examples from authoritative sources

Similar Expressions

52 human-written examples

As a biodegradable polymer, NPs are predicted to slowly release their content over time.

Plosone

The iPad 6 is predicted to be released for sale in 2014.

The Guardian - Tech

This project sought to explain the difference between the amount of neutrinos predicted to be released by the sun and the smaller number actually detected on earth; the Nobel Prize was awarded for work done by Raymond Davis Jr. of Brookhaven.

The New York Times

Ac-DAF-7 contains a characteristic C-terminal ligand domain that is predicted to be released from a propeptide by proteolytic cleavage at a tetrabasic cleavage site.

International Journal for Parasitology

The low tannin forage had a higher soluble N (a) fraction and a greater extent of degradation (a + b), resulting in a greater amount of N being predicted to be released in the rumen than the high tannin forage.

Livestock Science

Expert writing Tips

Best practice

Use "predicted to release" when you have a reasonable basis for expecting something to be made available, not just a vague hope. Use credible sources like expert analysis or official announcements to support your prediction.

Common error

Avoid using "predicted to release" based solely on personal desires or unsubstantiated rumors. This can lead to inaccurate communication and erode credibility. Instead, rely on verifiable data or expert forecasts.

Linguistic Context

The phrase "predicted to release" functions as a verb phrase expressing a future expectation. As Ludwig AI states, it indicates something is expected to be made available or launched in the future, often based on analysis or forecasting, like in the example "The iPad 6 is predicted to be released for sale in 2014."

Expression frequency: Uncommon

Frequent in

Science

70%

News & Media

20%

Formal & Business

10%

Less common in

Wiki

0%

Encyclopedias

0%

Social Media

0%

Ludwig's WRAP-UP

The phrase "predicted to release" is a verb phrase used to express future expectations of availability or launch. According to Ludwig AI, this phrase is grammatically correct and usable in written English. It commonly appears in science and news contexts, suggesting a reliance on data or analysis to support the prediction. Ludwig's examples showcase diverse applications from product launches to chemical reactions. While interchangeable with phrases like "expected to launch" or "anticipated to unveil", it's crucial to ground predictions in credible sources to maintain accuracy and credibility. Using it in unsupported claims diminishes the strength of your statements.

More alternative expressions

Phrases that express similar concepts, ordered by semantic similarity:

expected to launch

Focuses on the action of launching something, emphasizing the initiation or beginning of its availability.

anticipated to unveil

Highlights the act of revealing or making something known, especially after it has been kept secret or private.

projected to debut

Emphasizes the first appearance or presentation of something to the public.

forecast to issue

Suggests a formal release or publication, often used in the context of reports or statements.

estimated to make available

Highlights the act of making something accessible or obtainable.

slated to introduce

Indicates that something is scheduled or planned for introduction.

foreseen to present

Stresses the act of showing or offering something for consideration or display.

believed to circulate

Focuses on the distribution or spreading of something among people or within a system.

rumored to dispatch

Implies that information about the release is based on unofficial or unconfirmed reports.

speculated to disseminate

Suggests that the release is based on conjecture or guesswork.

FAQs

How can I use "predicted to release" in a sentence?

You can use "predicted to release" to describe expectations of future releases, such as "The new software update is predicted to release next month" or "The study predicted the release of certain chemicals under specific conditions."

What are some alternatives to "predicted to release"?

Alternatives include "expected to launch", "anticipated to unveil", or "projected to debut" depending on the context.

What's the difference between "predicted to release" and "expected to release"?

"Predicted to release" implies a forecast or calculation, while "expected to release" suggests a general anticipation based on common knowledge or prior patterns.

Is it correct to say "The product is predicted to be released"?

Yes, both "predicted to release" and "predicted to be released" are grammatically correct. The passive form, "predicted to be released", is also valid and often used interchangeably.