Your English writing platform
Discover LudwigExact(18)
Cell plasma membranes can be rendered permeable by the use of nanosecond pulsed electric field.
Farmed salmon, often raised in pens that are permeable by surrounding ocean waters and fed a diet rich in fish meal and fish oil, have been of special concern to critics like the World Wildlife Fund.
The low-K+ KcsA structure is not permeable by Na+, K+, or Rb+, and the selectivity of its binding sites is different from that of the high-K+ structure.
But Ms. Ganteaume takes care to keep geographical borders loose and permeable by pointing out crosscurrents of influence that constantly moved through them, propelled by long-distance trade, wars, migrations and the forced displacements of entire Indian nations after the European arrival.
Cells were rendered permeable by incubation for 10 min at room temperature in 0.02 M HCl.
Embryos were rendered permeable by F08F8.2 (RNAi), which results in osmo-sensitivity that can be rescued by growth in osmotically balanced media [54].
Similar(42)
The PROTAC was constructed by fusing the N-terminal oligomerization and C-terminal instability domains of the X-protein to each other, and rendering them cell-permeable by the inclusion of a polyarginine cell-penetrating peptide (CPP).
After rendering the peptide with cell-permeable by fusing it to the cell-membrane transduction domain of the TAT protein (YGRKKRRQRRR), the resulting TAT-GluR2 peptide is able to disrupt both GluR2 endocytosis and LTD induction, without significant effects on LTP induction [26], [29].
First we examined the effect of the Hsp70-targeted peptide [ 12], which was made further cell-permeable by the addition of Antp (Antp-Hsp70) or R11 R11-Hsp700), on the cytotoxic activity of Antp-TPR toward cancer cells.
To further improve the cytotoxic activity of Antp-TPR toward cancer cells, we investigated the effect of a Hsp70-targeted peptide, which was made cell-permeable by adding the polyarginine with a linker sequence, on the cytotoxic activity of Antp-TPR in breast cancer cell lines.
The Hsp70-targeted peptide (YCAYYSPRHKTTF) [ 12] was made cell-permeable by adding helix III of the cell-penetrating antennapedia homeodomain sequence (Antp) [ 17] or polyarginine (R11; RRRRRRRRRRR) (italic) [ 18, 19] with a linker sequence of triple glycine (GGG) as follows: RQIKIWFQNRRMKWKKGGGYCAYYSPRHKTTF (Antp-Hsp70) or RRRRRRRRRRRGGGYCAYYSPRHKTTF R11-Hsp700).
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com