Your English writing platform
Discover LudwigSuggestions(2)
Exact(15)
(b) Second case - adhered part length 10 nm.
(a) First case - adhered part length 1 μm.
The problem of time dependence of unfilled pore part length is solved numerically.
Therefore, the part length is quantified as the summation of multiple lengths of sub-hops.
Fig. 5 Diagrammatic sketch of decision of the part length (a, b).
The sequence was split into 20 equal parts (where part length differed based on protein length).
Similar(45)
We sorted each group of genes into six bins according to the distance between first CDS part and TSS (when no intron is inserted within 5′-UTR this distance is equal to the 5′-UTR length whereas when an intron is inserted, it is equal to the sum of the two 5′-UTR part lengths plus the length of the intron) and looked for a difference between the two groups of genes within size bins.
The facility is particularly relevant to test modern BWR fuel designs which typically have complex features, such as part-length rods and mixing vanes that make the flow heterogeneous and challenging to accurately simulate (e.g. using sub-channel analysis codes or CFD tools).
The part-length (Agenet/Tudor domain) sequence of At2g17950 (FSSGTVVEVSSDEEGFQGCWFAAKVVEPVGEDKFLVEYRDLREKDGIEPLKEETDFLHIRPPPPR) was used as a query sequence for TBLASTN.
Check the opposite parts' lengths by holding them against each other to make sure they're equal.
The coding region of PRDX4 was PCR amplified in 4 separate parts, the length of each part being approximately 300 base pairs with an overlap of at least 60 base pairs between two consecutive fragments.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com