Sentence examples for not found most from inspiring English sources

Burton explained it this way: "For most of my career, I have not found most dialogue to be meaningful.

The sequence of the amino acids forming the putative thioether bridge (C97 to H116 coordinated to CuA in the pro-enzyme) was not found, most likely due to the large mass of 4.1 kDa, resulting on the sequence of IHCAYCNGGYTQVDSGFPDIDIQIHNSWLFFPFHR.

"We found very few orphans living there and could not find most of the HA [humanitarian assistance] we had given them," the report noted.

When she tried to pay their bills, Mrs. Packel, who enlisted the help of a forensic accountant, could not find most of the couple's money.

No matter how much we improve border security, no matter the penalties we impose on their employers, no matter how seriously they are threatened with punishment, we will not find most of them, and we will not find most of their employers".

HC could not find most of the validated deletions because the AS algorithm by nature has difficulty finding relatively long deletions.

However, there was minimal guidance in terms of what the GPs may or may not find most topical or challenging about those experiences.

"But I don't find most comedy funny".

You can't find these old records, and you certainly can't find most of this music on CD's".

Its compact shape is complemented by a reassuring weight, however, and a feeling of solidity that again, you won't find most other places in the crowded world of gaming PCs and components.

Asked by Williams about his television watching habits, Obama says he doesn't generally watch the cable news shoes: "Mainly because I don't find most of the cable chatter very persuasive.