Sentence examples for modification to the site from inspiring English sources

On the other hand, genome editing can be fulfilled by introducing the donor DNA, carrying a desired modification to the site of recombination via the Ends-In targeting strategy [ 42].

The National Trust also objected, citing the "seemingly endless modifications" to the site, "each increasing the development density and height and which confirm the inherent defects in the current planning system".

We have noted especially within Mka and Iho, that there are frequently two or more sRNAs that are predicted to target modification to the same site in rRNA (Table  2).

Here we utilize our published fluorescent ABPs GB123 comprised of an electrophilic acyloxymethyl ketone warhead that generates a specific covalent modification to the active site cysteine of cathepsins B, L and S. GB123 can freely penetrate cells thereby targeting a larger pool of active intracellular and extracellular enzymes resulting in high signals in vivo detected non-invasively [ 29, 30].

At STAT1 binding sites that are normally inaccessible to RNApolII, this could involve chromatin modification to make the site more accessible to RNApolII.

Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.

The integrated proviruses generated through this path are commonly replication competent; however, due to some epigenetic modifications at the site of integration, they become transcriptionally silent [ 56].

No codon optimization or modifications to the polybasic cleavage site were made in order to exactly match the HA sequence of the transmitted avian influenza strain [10].

This eliminates the need for direct modifications to the aptamer binding site.

And upon making slight modifications to the internal SD site, the ribosomal pause was found to disappear.

For siRNAs containing these dinucleotide sites, even single modifications to the sugar backbone within the sites were sufficient to significantly increase stability.