Sentence examples similar to mix map from inspiring English sources

Suggestions(1)

Similar(59)

Inside Google, engineers have already experimented with hacking the phone and building applications that, say, mix maps and location-based services so you can tell where your friends are.

This map follows the suggestion of Hargrove and Hoffman (2004) that the clustering of the three color mixing maps into map classes can improve the multivariate interpretation.

An in-house developed MIX-MAP ELISA against was used to detect KSHV seropositivity as previously described [7] but with an improved, modified peptide containing two copies each of a lytic and a latent epitope (RSHLGFWQEGWSGQVYQDWLGRMNCSYENM derived from K8.1, and QPGPSREYRYVLRTSPPHRPGVRMRRV derived from ORF 73, respectively).

But one of the special sauce bits that Apple is adding to the mix of mapping tools is a full-on point cloud that maps in 3D the world around the mapping van.

If recent and forecast weather data are added to the mix, detailed maps can be produced indicating exactly how, where and when crops should be grown.

When the online giant launched the service, programmers quickly figured out how to mix the maps with other sources of information.

It is based on the scrupulous tracking of crime complaints and a mix of mapping crime trends, identifying trouble spots and holding precinct commanders directly responsible for attacking those problems.

It contains an unusual mix of maps, including those that show the distribution of protected areas, coral species, coral diseases, and commercial dive centers.

(b) Mixing coefficient maps associated with the second independent components in Figure 5.

We have discussed the possibility of considering some constructs equivalent, including Parameters and Variables, with the Mixed construct-mapping mode (Section 3.6).

The employed mathematical tools could help assessing the bit-mixing and mapping properties of a large class of iterated functions, performing only non-multiplicative computer operations: SHIFT, ROTATE, ADD, and XOR.

Show more...

Your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: