Suggestions(1)
Exact(4)
Figure 7 Measured shift of the central wavelength in case of tilting and pore-filling.
Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.
The measured shift of the central wavelength as a function of the tilt angle is shown in Figure 5.Measurements for demonstration of the dual tunability induced by tilting and pore-filling were performed using a rugate photonic crystal having 32 periods and a central wavelength at 700 nm.
Ref. 1 also reports a measured shift of 325±40 ppm for the HFS constant of K at N=8000, which is in reasonable agreement with our prediction.
Similar(56)
The potentials as well as the limitations of this technology are presented in this paper through a comparative study of the predicted and measured shifts of natural frequencies due to dimensional deviations of cylinders and flat plates.
Furthermore, the calculated shifts across the hydride transfer step for the T46C-CN and L54C-CN probes are −3.7 cm–1 and −2.5 cm–1, respectively, compared with the experimentally measured shifts of −4.1 cm–1 and −1.0 cm–1, respectively.
The upper exposure action level and exposure limit 85 dB LAeq was reached or exceeded in three measurements from three different shifts, corresponding to 5% of all measured shifts or 0.6% of all measurements.
The lower action level 80 dB LAeq was exceeded in 30 different dosimeter measurements during 28 different work shifts, which corresponds to 46% of all measured shifts or 6% of all dosimeter measurements.
The remaining 41 events occurred in 17 different shifts corresponding to 28% of all measured shifts or 8% of all dosimeter measurements.
A bit to the north, for example, on the flanks of Mount Kenya, other scientists have been able to measure shifts in patterns of ice loss that show solar radiation -- the long-term influence on the ice -- is no longer dominating.
These simulations demonstrate that our method is capable of accurately measuring shifts in the presence of gain, offset and shape changes for neurons with a variety of heading preferences.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com