Sentence examples for measured shift from inspiring English sources

The maximum measured shift in coercive field exceed 200 Oe for 10 ns pulse.

Figure 7 Measured shift of the central wavelength in case of tilting and pore-filling.

Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.

The total measured shift is Δ m ~ 29 micropads being therefore lower than the expectation Δ m ~ 37.

For example, a wavelength shift of 15 nm was measured (shift from 610 nm at 5 V to 625 nm at 10 V) at 197 K (Δλ/λ = 2.40% for Δ F = 119 kV/cm).

We assessed the significance of each measured shift by fitting a single cumulative Gaussian to the combined data at a single site and comparing log likelihoods (χ, p < 0.05).

The upper exposure action level and exposure limit 85 dB LAeq was reached or exceeded in three measurements from three different shifts, corresponding to 5% of all measured shifts or 0.6% of all measurements.

The lower action level 80 dB LAeq was exceeded in 30 different dosimeter measurements during 28 different work shifts, which corresponds to 46% of all measured shifts or 6% of all dosimeter measurements.

The remaining 41 events occurred in 17 different shifts corresponding to 28% of all measured shifts or 8% of all dosimeter measurements.

The team compiled 34 scientific papers that measured shifts over time in exploited species' breeding schedules, overall size, or size of specific body parts.

We measured shifts in the preference for sweetened morphine versus a highly palatable saccharin solution.