Sentence examples for mass fingerprint analysis from inspiring English sources

However, peptide mass fingerprint analysis of the peptide in this study yielded different fragments (Figure 6) and the bioinformatic analysis of one of the largest peptide fragment sequence (KLFKEFINTPEPTWNDVEHLLKK) showed 34% hydrophobicity.

MALDI peptide mass fingerprint analysis was done on a Reflex IV mass spectrometer (Bruker Daltonics,Germany).

The protein was identified as an adenine-specific DNA methyltransferase from H. pylori by peptide mass fingerprint analysis.

All proteins were identified by peptide mass fingerprint analysis resulting in very low expect values (Table 1).

In the cases where masses remained that could not be assigned to the identified proteins, a secondary peptide mass fingerprint analysis was done with these remaining masses.

The resulting tryptic fragments were subjected to peptide mass fingerprint analysis by MALDI-TOF-MS and MASCOT analysis of the mass lists.

Peptide mass fingerprinting analysis shows SCRII belongs to short-chain dehydrogenase/reductase family.

We also purified the endogenous enzyme from the pharate pupal cuticle and used peptide mass fingerprinting analysis to confirm that it is laccase-2.

Digested and dried samples were subjected to peptide mass fingerprinting analysis using the Georgia Institute of Technology Bioanalytical Mass Spectrometry Facility.

Peptide Mass Fingerprinting analysis of the band migrating at approximately 50 kDa revealed it to be human GFAP (MOWSE score: 303 with 28 matching peptides).

Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.