Your English writing platform
Discover LudwigSuggestions(1)
Exact(2)
Our results showed that the detection power and resolution of QTL mapping were significantly improved by using the ultra-high density SNP bin map.
Interestingly, in rats visual object orientation and auditory tonotopic cortical mapping were significantly less organized than in primates (Ohki et al., 2005; Rothschild et al., 2010).
Similar(58)
The pitch ranking results with the AMO showed that Std mapping was significantly poorer than either of the Smt mappings for the tone pair D-D# (1-semitone interval) in all three octave ranges.
With 3-semitone intervals, Std mapping was significantly poorer than Smt-LF mapping at the lowest octave (D3-F3) only.
Accordingly, the ratio of learning trials between the second and the first occurrence of the shift mapping was significantly below unity (p<0.01, Wilcoxon signed rank test), which implies facilitation of learning for the second mapping (Figure 3B).
To verify that the section chosen for mapping was significantly different from adjacent sections, a paired t-test was used to compare the maximum feret measurement of the LV across three consecutive sections (Figure 1).
The fractions of uniquely and multiply mapped reads were similar for all libraries except for the ARK1_3940 antibody, where the mapping was significantly lower.
Taken together, these data demonstrate that the use of a tDNA-based exclusion list for tRNA modification mapping is significantly more effective than the standard DDA approach.
Site mapping was significantly facilitated by using the four proteases and both the phosphoRS score [ 32] and the search engine results, e.g. for four peptides MSPYETHV, MSPYETHVSTDLVGTL, RLMSPYETHVSTDLVGTL and LMSPYETHVSTDLVGTLGYIPPEYGQASVATYK, covering the phosphorylation site Thr (Supplementary Figures S1A S1D respectively).
We found that the frequency of EBV integration mapping was significantly lower than the average coverage depth (~70X), implying the DNA sample derived from a clonal cell population is potentially more diverse than previously thought, and that this method could reveal the heterogeneity of a very complex sample population at the single-molecule level.
On admission, stroke volume (SV), cardiac index (CI), oxygen delivery index and mean arterial pressure (MAP) were significantly lower in patients who died despite similar fluid resuscitation volume.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com