Sentence examples for majority of kind from inspiring English sources

Thorough examination of all available mammalian Spire1 isoforms revealed at least 3 alternatively-spliced exons, which we refer to as exons A (majority of KIND domain), B (protein sequence AVRPLSMSHSFDLS), and C (protein sequence VPRITGVWPRTPFRPLFSTIQTASLLSSHPFEAAMFGVAGAMYYLFERAFTSRWKPSK).

As Asher and Pelletier (Asher and Pelletier 1997) have argued, the semantics for such sentences seems to involve intentionality: a generic sentence can be true even if the majority of the kind, or even all of the kind, fail to conform to the generalization.

The moment the Duke Blue Devils were named the 2015 NCAA Champions, my social media feeds exploded with messages from and to Badger fans -- the majority of them kind words and support for the group of young men who were likely feeling all kinds of awful.

Mr Brown still has a parliamentary majority of a kind John Major eventually lacked, but he is almost as emasculated.

The candidates with strong Tea Party support — Joe Miller of Alaska, Ron Johnson of Wisconsin, and Sharron Angle of Nevada — "are not candidates who represent a potential majority of any kind in this country, nor do they represent the longer-term demographic trends in this country — that is to say the votes of young people, of immigrants, of minorities, and of women," Packer says.

To date, the vast majority of this kind of research has been undertaken in high-income settings.

In practice, though, the vast majority of these kinds of acts are not carried out by thugs who belong to hate-fomenting organizations.

Usually, the desired impedance is chosen to be a second-order linear equation, as in mass-spring-damper system; however, in majority of the kinds of rehabilitation exercises, the speed of the robot is relatively low, so the acceleration effect can be neglected [27],[28], resulting Equation 16 to be degenerated to the following equation: B d x ̇ − x ̇ d + K d ( x − x d ) = F m (17).

It should be taken into account that the majority of these kinds of analyses have been based on predictive computational methods and/or in cDNA sequences deposited in different databases (Pan et al. 2005; Xing and Lee 2005; Nurtdinov et al. 2007).

Tocqueville's crucial insight, in this view, is that democracy in America would always have to guard against popular despotism, the tyranny of the majority — the kind of contempt for excellence and appeal to the lowest common denominator which led to the nanny state in Washington and grade inflation at Harvard.

For the others, indeed the majority of cases, a kind of purgatory prevails.