Sentence examples for last we found that from inspiring English sources

Exact(7)

Last, we found that SMF-3 N-terminal sequence contains a putative Mitochondrial Targeting Sequence (MTS, probability 93.66% given by MitoProt, http://ihg2.helmholtz-muenchen.de/ihg/mitoprot.html): MPRVHRQSRWNSVSFSGFFLQISGIKPRF.

At last, we found that in both the Foxg1Cre and Wnt1 Cre lines, some recombination occurs at early somitic stages in the area of dbx1 expression in the midbrain (Fig. S3M, N; compare with Fig. 3N), suggesting that the EM subset is partially targeted by these two lines.

Last, we found that neuronal excitability was more pronounced in adult versus juvenile tissue.

At last, we found that signatures of the aberrant miR-376a were expressed in early second-trimester serum samples of macrosomia pregnant women.

Last, we found that drainage of approximately 20% of the sporozoite inoculum to the lymphatics is associated with a significant enlargement of the draining lymph node, a response not observed after intravenous inoculation.

Last, we found that V5/MT response entropy (Fig. 3) changed markedly during the initial period of vestibular activation (where vestibular activation is maximal), in stark contrast to highly stable response entropy in the pre- and postvestibular epochs.

Show more...

Similar(53)

In the last couple of months we found that wasn't the case.

Since, in view of (a), we have | x ′ ′ | ≤ M 0 + M, from the last formula we find that | x ′ ( t ) | ≤ | x ′ ( 0 ) | + | x ′ ′ | ≤ min { | a |, | b | } + M 0 + M, t ∈ [ 0, 1 ], which proves (b) and completes the proof of the lemma.

However, the control group has been asked about having a waged employment in the last 6 months, and we find that only 15.1% report to have been employed.

Letting in the last inequality, and using (2.19), we find that (2.22).

Last but not the least, we find that public trust towards police is closely tied to their trust in society and justice.

Show more...

Ludwig, your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: