Lack of CSP-α in photoreceptor terminals impaired assembly of the SNARE complex, which is required for membrane fusion and the development of ribbon synapses, leading to progressive neurodegeneration (Sharma et al., 2011).
Conversely, modifying the amine attached to C2 (2-amine) caused a loss of binding, judging by the lack of CSPs in NMR tests of two compounds with 2-amine pendants.
CSPs' lack of knowledge about the needs of Aboriginal people with cancer and Aboriginal patients' limited understanding of the Western medical system were identified as the two major impediments to communication.
The molecular mechanism underlying VHL-associated CSPs is debated (Supplementary Material, Table S16) and the lack of tumourigenesis in VHL-associated CSPs is notable.
Sporozoites expressing a mutant CSP which lacks the N-terminus (CSΔN), thus mimicking the proteolytically processed form of CSP, display normal infectivity when inoculated intravenously (Coppi et al., 2011).
Upon successful integration of the CSΔN construct, the wild-type copy of CSP is replaced by a truncated version lacking the amino acids NKSIQAQRNLNELCYNEGNDNKLYHVLNSKNGKIYNRNTVNRLLADAPEGKKNEK KNEKIERNNKLKQP, which encompass the entire N-terminal region, except for the signal sequence.
However, anonymous identity management also has some shortcomings, such as lack of trust between the CSCs, and CSPs.
It is probably because of a lack of understanding, among both physicians and CSPs, of the fundamental difference between the system and the lifeworld and a lack of ability among professionals to operate within the realm of a non-biomedical discourse.
Key themes that emerged as barriers to communication for CSPs were their lack of knowledge about the cultural, social and health needs of Aboriginal people; the marginalization of Aboriginal people within the system; and Aboriginal patients' distrust of the health system and fundamental aspects of communication, including language and communication style.
The AUC values of total heterozygosity are lower than that of CSP and this is because there are considerable CFs which do not show heterozygosity due to the lack of coverage and absence of heterozygous SNPs in overlapped regions.
