Sentence examples for internal testes from inspiring English sources

Exact(10)

That stunning victory meant the South African was subjected to gender tests, published rumours (never confirmed) that she had internal testes instead of a womb and ovaries, and an official ruling that women with high levels of testosterone would need to take hormones to bring them back to acceptable, "normal" levels.

Each of the women ended up having surgery to remove internal testes, and each went on estrogen-replacement therapy.

Who do you think I should marry as an XY female who was born with internal testes?

She has always identified as a woman, but she has many of the physiological features of a man, including, according to a medical report in 2009 that was leaked to the press, internal testes and an exceptionally high testosterone level.

And I was living as female because when I was born, I was born with a very small penis, and internal testes, and XY chromosomes.

They removed my little internal testes when I was eight-years-old, telling me I was a "special little girl" and my "ovaries would become cancerous when I was a teen".

Show more...

Similar(50)

Hanne was born with androgen insensitivity syndrome, meaning that although she physically appears to be biologically female, she has XY chromosomes and was born with internal, undescended testes.

Furthermore, male gonad-specific Sf-1 − / − mice display hypoplastic testes and internal genitalia, undescended testes, and infertility (7).

In the rat, malformations of internal reproductive organs (epididymis, testes) are the consequence.

These spots from EC 14 Ds testes were excised, and the internal N-terminal amino acid sequences were determined by mass spectrometry (spot I, LGEYGFQNAILVRYTQKAPQVSTPTLVEAAR, Fig. 1B, highlighted in green and red; spot II, VRYTQKAPQVSTPTLVEAAR, Fig. 1B, highlighted in red) and compared with known sequences using the NCBInr database.

Western blot analyses showed significant differences in the expression of MC3R and MC4R in the lizards' brain and testes, using actin as an internal standard.

Show more...

Ludwig, your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: