Sentence examples for internal testes from inspiring English sources
That stunning victory meant the South African was subjected to gender tests, published rumours (never confirmed) that she had internal testes instead of a womb and ovaries, and an official ruling that women with high levels of testosterone would need to take hormones to bring them back to acceptable, "normal" levels.
Each of the women ended up having surgery to remove internal testes, and each went on estrogen-replacement therapy.
Who do you think I should marry as an XY female who was born with internal testes?
She has always identified as a woman, but she has many of the physiological features of a man, including, according to a medical report in 2009 that was leaked to the press, internal testes and an exceptionally high testosterone level.
And I was living as female because when I was born, I was born with a very small penis, and internal testes, and XY chromosomes.
They removed my little internal testes when I was eight-years-old, telling me I was a "special little girl" and my "ovaries would become cancerous when I was a teen".
Hanne was born with androgen insensitivity syndrome, meaning that although she physically appears to be biologically female, she has XY chromosomes and was born with internal, undescended testes.
Furthermore, male gonad-specific Sf-1 − / − mice display hypoplastic testes and internal genitalia, undescended testes, and infertility (7).
In the rat, malformations of internal reproductive organs (epididymis, testes) are the consequence.
These spots from EC 14 Ds testes were excised, and the internal N-terminal amino acid sequences were determined by mass spectrometry (spot I, LGEYGFQNAILVRYTQKAPQVSTPTLVEAAR, Fig. 1B, highlighted in green and red; spot II, VRYTQKAPQVSTPTLVEAAR, Fig. 1B, highlighted in red) and compared with known sequences using the NCBInr database.
Western blot analyses showed significant differences in the expression of MC3R and MC4R in the lizards' brain and testes, using actin as an internal standard.
