This mutant is herein defined as P229fs as it includes the first 229 residues (instead of 925 residues in the WT RIG-I protein) followed by 4 unintended residues (i.e. FRSV; Fig. 1B) and thus, does not contain the helicase and the RD domains.
FXN-3 C-terminus contains 11 residues instead of 48 residues of the FXN-1 (RLTWLLWLFHP in place of SGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGK).
Moreover, two additional peptidases from L. plantarum and L. casei (LPL_28379307 and LCA_116494294) which are not grouped into the PepR subfamily also have glutamate catalytic residues instead of aspartate residues.
In comparison to SP25, SP22s contain (Z -ΔAbu instead of valine residue in the depsipeptide ring.
A previous study showed that reading times were faster in unprepped patients who had more segments with fluid instead of dry residue faeces [ 22].
Noteworthy, another positive charged amino acid (N97) was found in Z. sapae HOs instead of K99 residue found in S. cerevisiae HO.
Regarding that serine or threonine is able to form an additional hydrogen bond with other part of proteins, it is highly possible that hydrophobic phenylalanine instead of serine residue in bri1-120 conformationalational change of LRR motif in the BRI1.
These increases were always considerably faster when the linker consisted of 16 residues (in 17Ala-L16-CspB 17Ala-L16-CspB 17Ala-L16-CspB17Ala-L3-CspB (Finstead cofpare triangles versus circles).
The only constant difference in the conserved amino acid residues in Micrasterias when compared to land plants is the occurrence of a serine residue instead of an alanine residue in the GGACGY motif of the GH45 domain.
Moreover, we predict that its hydrophobic contribution will also be reduced because the conserved hydrophobic motif of AT4G33240-FYVE possesses a valine residue instead of a leucine residue found in AT3G14270-FYVE (Fig. 4).
