Your English writing platform
Discover LudwigSimilar(60)
4. Issuing payment service providers shall ensure that their payment instruments are visibly and electronically identifiable, enabling payees to identify unequivocally which brands and categories of prepaid, debit, credit or commercial cards or card based payments based on these are chosen by the payer.
It also made possible to identify unequivocally each analyte.
A small myelinated axon ran perpendicular to the image plane and was visualized amongst 18 unmyelinated excitatory axons, one inhibitory axon, and 38 axon portions that were too small to identify unequivocally (Fig. 2d).
A rapid and accurate PCR method with fluorescent probes has been developed to identify unequivocally the vaccine-specific poliovirus strains, such as Mahoney, MEF-1, Saukett H, Sabin type 1, Sabin type 2 and Sabin type 3.
The limit of quantification is defined as the concentration on which a substance is identified unequivocally and quantified with a relative standard deviation of 20%% or lower.
Eight pigments were identified unequivocally from 125 watercolour paintings analysed, suggesting that Bauer used a more traditional and more limited palette than previously considered, and that his palette changed significantly in his later paintings.
Table 3 Results of survey of six Raman excitation lasers on watercolour pigments Table 4 Number of pigments identified using different excitation wavelengths Excitation wavelength (nm) Pigments identified unequivocally Pigments identified with weak peaks or peaks obscured by fluorescence 488 13 21 532 19 25 633 17 26 785 12 19 830 18 32 1064 10 15.
We believe it will identify unequivocally what initiatives show the most promise for curbing youth violence, helping at-risk youth and assisting economically the communities hardest hit by crime and poverty.
In addition, another Not4p peptide (318 361 AQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQSATPVTSINLSK) was identified by mass spectrometry as a singly-phosphorylated peptide (data not shown), but the phospho-acceptor site could not be identified unequivocally.
Cells with CD133 expression lower than that of HCT116 wild-type cells may be hard to identify unequivocally with this imaging method unless a proper negative control is available.
Most reported studies lack statistical power to identify unequivocally any single risk factor for the development of malignant gliomas.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com