identified unequivocally

USAGE SUMMARY

The phrase "identified unequivocally" is correct and usable in written English.
It can be used when you want to express that something has been recognized or determined in a clear and unambiguous manner. Example: "The evidence presented in the report identified unequivocally the source of the contamination."

✓ Grammatically correct

Science

Formal & Business

News & Media

Human-verified examples from authoritative sources

Exact Expressions

11 human-written examples

The limit of quantification is defined as the concentration on which a substance is identified unequivocally and quantified with a relative standard deviation of 20%% or lower.

Environmental Sciences Europe

Eight pigments were identified unequivocally from 125 watercolour paintings analysed, suggesting that Bauer used a more traditional and more limited palette than previously considered, and that his palette changed significantly in his later paintings.

Heritage Science

Table 3 Results of survey of six Raman excitation lasers on watercolour pigments Table 4 Number of pigments identified using different excitation wavelengths Excitation wavelength (nm) Pigments identified unequivocally Pigments identified with weak peaks or peaks obscured by fluorescence 488 13 21 532 19 25 633 17 26 785 12 19 830 18 32 1064 10 15.

Heritage Science

In addition, another Not4p peptide (318 361 AQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQSATPVTSINLSK) was identified by mass spectrometry as a singly-phosphorylated peptide (data not shown), but the phospho-acceptor site could not be identified unequivocally.

Plosone

To date, toxicologic studies have not identified unequivocally specific PM constituents or mechanisms to account for the epidemiologic observations.

Environmental Health Perspectives

3. The kinase(s) responsible for the early activating phosphorylation on Ser174 of CPEB should be identified unequivocally.

Biochimica et Biophysica Acta - General Subjects

Human-verified similar examples from authoritative sources

Similar Expressions

49 human-written examples

4. Issuing payment service providers shall ensure that their payment instruments are visibly and electronically identifiable, enabling payees to identify unequivocally which brands and categories of prepaid, debit, credit or commercial cards or card based payments based on these are chosen by the payer.

European Parliament

It also made possible to identify unequivocally each analyte.

Analytica Chimica Acta

A small myelinated axon ran perpendicular to the image plane and was visualized amongst 18 unmyelinated excitatory axons, one inhibitory axon, and 38 axon portions that were too small to identify unequivocally (Fig. 2d).

Nature

A rapid and accurate PCR method with fluorescent probes has been developed to identify unequivocally the vaccine-specific poliovirus strains, such as Mahoney, MEF-1, Saukett H, Sabin type 1, Sabin type 2 and Sabin type 3.

Journal of Virological Methods

We believe it will identify unequivocally what initiatives show the most promise for curbing youth violence, helping at-risk youth and assisting economically the communities hardest hit by crime and poverty.

HuffPost

Expert writing Tips

Best practice

Use "identified unequivocally" when you need to emphasize that something has been recognized or determined in a clear, unambiguous, and authoritative manner. This phrase is particularly useful in scientific, legal, or formal contexts where precision is essential.

Common error

Avoid using "identified unequivocally" in informal contexts where simpler alternatives like "clearly identified" or "definitely identified" would be more appropriate. Overly formal language can sound stilted or unnatural in casual conversation or writing.

Linguistic Context

The phrase "identified unequivocally" functions as an adverbial modifier, adding emphasis to the verb "identified". It indicates that the identification was done without any ambiguity or doubt, as supported by the Ludwig AI's analysis.

Expression frequency: Uncommon

Frequent in

Science

80%

Formal & Business

10%

News & Media

10%

Less common in

Wiki

0%

Encyclopedias

0%

Social Media

0%

Ludwig's WRAP-UP

In summary, "identified unequivocally" is a phrase used to express clear and unambiguous identification. As Ludwig AI confirms, it's grammatically correct and most commonly found in scientific and formal contexts. While useful for emphasizing certainty, it should be used judiciously in less formal settings where simpler alternatives are more appropriate. The examples provided by Ludwig illustrate its use across various scientific domains, highlighting its role in ensuring precision and clarity.

More alternative expressions

Phrases that express similar concepts, ordered by semantic similarity:

clearly identified

Replaces "unequivocally" with a more common synonym, maintaining the emphasis on clarity.

unambiguously identified

Uses a direct synonym for "unequivocally", focusing on the lack of ambiguity.

definitively identified

Emphasizes the conclusive nature of the identification.

conclusively identified

Highlights the finality and certainty of the identification.

positively identified

Focuses on the affirmative nature of the identification.

irrefutably identified

Stresses that the identification cannot be disproven.

unquestionably identified

Implies that there is no doubt about the identification.

certainly identified

Conveys a sense of assurance and confidence in the identification.

distinctly identified

Emphasizes the clear and separate nature of the identification.

precisely identified

Highlights the accuracy and exactness of the identification.

FAQs

What does "identified unequivocally" mean?

The phrase "identified unequivocally" means something has been recognized or determined in a clear, unambiguous, and authoritative manner, leaving no room for doubt or misinterpretation.

How can I use "identified unequivocally" in a sentence?

You can use "identified unequivocally" to emphasize the certainty of an identification, as in "The study "clearly identified" the gene responsible for the disease" or "The suspect was "positively identified" by multiple witnesses".

What are some alternatives to "identified unequivocally"?

You can use alternatives like "clearly identified", "unambiguously identified", or "definitively identified", depending on the context and the desired level of formality.

Is "identified unequivocally" formal or informal?

"Identified unequivocally" is a relatively formal phrase. In more casual contexts, simpler alternatives like "clearly identified" or "definitely identified" may be more appropriate.