Sentence examples for has a polyethylene from inspiring English sources

The Lapinator, which is insulated with a heat-blocking material, has a polyethylene surface to prevent slipping, bumpers that lift the back of the computer for ventilation and a Velcro strap that holds cables; $24.95 (or $29.95, for a larger version) from (800) 809-5658 or lapinator.com.

This graft copolymer has a polyethylene glycol (PEG) backbone as hydrophilic part and vinylcaprolactam/vinyl acetate side chains as lipophilic structure.

The device developed has a polyethylene terephthalate (PET) substrate, bottom contacts, and poly (3,3′′′-didodecylquaterthiophene) (PQT-12) cast from 4 mg/mL cholorobenzene solution as active semiconductor.

Unlike Doxil, the Myocet liposome does not have a polyethylene glycol coating, and therefore does not result in the same prevalence of hand-foot syndrome.

Peptides were synthesized on NovaPeg Rink amide resin (NovaBiochem) and had a polyethylene glycol (PEG10) spacer (Polypure) between the c-terminus of the peptide identified from the phage and the cysteine used to multimerize the peptides (HCC15.1 – ATEPRKQYATPRVFWTDAPG- PEG10 -C-NH2, H1299.3 – LQWRRDDNVHNFGVWATEPRKQYATPRVFWTDAPG- PEG10 -C-NH2

The tibial polyethylene plate has a central polyethylene post placed on the middle of the plate.

The purpose of the present study was to evaluate the clinical and radiographic outcomes of the EIUS unicompartmental design, which has an all-polyethylene tibial component, and to compare these outcomes with published reports of other unicompartmental prostheses.

Mount Cuba now has a similar Cintoflex polyethylene fence; one source for it is Wayside Fence of Bay Shore, N.Y., (800) 847-7789, www.waysidefence.com.com

The polymer has a global hyperbranched polyethylene backbone and multiple covalently bonded pyrene moieties as branch ends.

The Duraloc 1200 cup was considered a second-generation cup because it had a minimum polyethylene thickness of 6 mm, dome-loading of the polyethylene, and an improved locking mechanism designed not to interfere with liner shell conformity [34].

We designed the hybrid molecules SNIPER TACC3 -1 and -2 in which KHS108 is linked to bestatin via a linker having a different polyethylene glycol (PEG) unit.