Sentence examples for generated in rabbit with from inspiring English sources
Totally 11 positive clones, which designated as HqL01-11, were obtained by immunoscreening of the library using a polyclonal antibody generated in rabbit with larval tick protein extract.
Polyclonal antibodies against Dnmt2 and Su var)205 were generated in rabbits with use of the peptides Dnmt2-7A53-2 (amino acids 64 84) and Su var)205 3C78-2 (amino acids 72 91).
Anti-isoQC 5406 was generated in rabbit by immunization with the peptide MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRC and anti-isoQC 5407 was generated by immunizing a rabbit using the peptide MSPGSRGRPRQRLEDRGLMKPPSLSKRRLLPRVQC.
Anti-CAHL polyclonal antibody serum was generated in rabbits immunized with CAHL1237-1251, ILHPKRGTEDRSDQS, according to our lab protocol [35].
Antibodies against P. aeruginosa LasR and RhlR were generated in rabbits immunized with His10-LasR or His10-RhlR affinity-purified under denaturing conditions.
Polyclonal antibodies against PstPc were generated in rabbit.
The polyclonal antibody (anti-pT39) was generated in rabbit, and purified on phosphospecific affinity columns.
S-labeled IVT Ngn3 was generated in rabbit reticulocyte lysate (Promega) containing S-methionine (PElmer Elmer).
Our cofilin antibody was generated in rabbit by Covance from purified human cofilin; sera from inoculated rabbits rather than purified antibody was used in immunofluorescence assays.
Antibodies against PEG have been generated in rabbits and mice immunized with PEGylated proteins, including uricase from Candida utilis, in the presence of Freund's adjuvant [ 30- 32].
The membranes were blocked with 5% skimmed milk dissolved in PBS with 0.1% Tween20 and then incubated with 1 2,000 diluted primary antibodies generated in rabbits (Beijing Protein Innovation Ltd., Co. Beijing, China) at 37°C for 1 h.
