Sentence examples for fused with a from inspiring English sources

A modern education is fused with a culturally orthodox ethos.

Skeleton of spicules fused with a horny material.

The Smiths offer stinging vignettes of loneliness and poetic insult fused with a sense of politics and uplifting music.

One wooden armoire, half-filled with cement, has been fused with a bed frame, rendering both functionless.

Tumor cells from a patient with B-cell lymphoma were fused with a mouse myeloma cell line.

Their solos were fresh and original, and their individual styles fused with a spontaneous fluency that was simply astonishing.

The catalase cDNA were fused with a DNA sequence encoding the mitochondria-targeting peptide (MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQ), resulting in mtCAT cDNA.

This is a pentatonic scale that has been fused with a 12-tone progression.

Yet this presentational style and refinement are always fused with a strength that owes something to Russian training.

We, therefore, employed ABD proteins fused with a helical TolA spacer protein.

Yet Obama knew that the often-irate legions of the blogosphere needed to be fused with a soft-spoken center weary of partisanship and division.