The frequency of spot-forming cells (SFC) was measured with an automated microscope (Zeiss).
A frequency of spots below 20 was considered as non significant.
In the presence of SDS, the frequency of spots belonging to the RF≤1 class significantly decreased as the Aβ/QD ratio increased (QDAβ(0)>QDAβ(1)>QDAβ(6)) (Table S1b).
The frequency of spots for IFN-γ was significantly reduced (p<0.001) in recipients that received donor apoptotic cells, when compared to mice left untreated or injected with BALB/c splenocytes alive or necrotic, or with C3H apoptotic cells (Fig. 7A).
In a CD8 response, the highest frequency of spots (1538 spots per 1 × 10 CD8+ T cells) was obtained from a patient with no CIN (patient 27), again in response to an E6 peptide (KLPQLCTELQTTIHDIILECVYCKQQLLRREV; aa 18 49).
Analyzing the relative sizes and frequencies of spots and ripples over the years has allowed astronomers to describe the birth of the universe to a precision that would make the philosophers weep.
The natural cyclic bleeding ceases during the first month of treatment and thereafter reaches amenorrhea as in pattern number 3. The bleeding patterns 5 and 6 in Figure 5 both show a high frequency of undesirable spotting or bleeding.
The frequency of any spotting (body or face) among E D E + heterozygotes in this study was 0.2, so to confirm that the QTL detected was indeed degree of black and not a false positive association with spotting, two additional analyses were performed.
We observed that the Δ ctb2 strains also caused rarely necrotic spots, but the frequency of this spots was influenced by the quality of the inoculum.
The RP column effluent was mixed with the MALDI matrix solution (4 mg/mL α-cyano-4-hydroxycinnamic acid dissolved in 70% acetonitrile containing 0.1% TFA and 80 μg/mL dibasic ammonium citrate) flowing at a rate of 1400 nL/min at the outlet, and spotted directly onto the ABI 4800 MALDI-plates in a 24 × 16 array at a frequency of two spots per minute.
