Your English writing platform
Discover LudwigExact(60)
Peptide mass fingerprinting analysis shows SCRII belongs to short-chain dehydrogenase/reductase family.
The aim of this study was to develop and evaluate SSRs in crape myrtles as well as to evaluate genetic diversity and to perform fingerprinting analysis.
We also purified the endogenous enzyme from the pharate pupal cuticle and used peptide mass fingerprinting analysis to confirm that it is laccase-2.
HPLC fingerprinting analysis was performed on an Agilent1100 series LC system consisting of a G1311A Quart pump, a G1322A degasser, a G1315A photodiode array detector (DAD) and a G1313A automatic liquid sampler (ALS).
Peptide fingerprinting analysis of the ODN binding protein (referred to as NCC cationic anti-microbial protein-1/ncamp-1) identified a peptide that was used to design degenerate primers.
Digested and dried samples were subjected to peptide mass fingerprinting analysis using the Georgia Institute of Technology Bioanalytical Mass Spectrometry Facility.
The origin of AFiPSC cell lines 4, 5, 6, 10, and 41 was confirmed by fingerprinting analysis, as previously described [34].
Finally, mass spectrometric peptide fingerprinting analysis of anti-ΔP immunoprecipitate was performed to substantiate the above results and to determine the identity of the 100-kDa anti-ΔP immunoreactive band.
Mass fingerprinting analysis of CifPl localises the site of modification to the cysteine-containing peptide 'IDESVSELGGLEMYQEMVGVNPYDPTEPVCGLSAQNIFK', which shifts from 4261.5 Da (theoretical mass of 4260.8 Da) to 4472.8 Da (theoretical mass 4471.7 Da), an experimentally measured shift of 211.3 Da.
The peptide mixtures were bound to NP20 ProteinChip Arrays and analyzed using SELDI-TOF mass spectrometry for fingerprinting analysis and with a MALDI-TOF/TOF (ABI 4800) mass spectrometer to identify specific peptides.
The collected supernatants were lyophilized to remove salts and washed again with 35 µl TFA 0.1% before sample concentration to 2 5 µl. 1 µl was loaded on a MALDI plate and after matrix addition, sample acquisition was performed using the MALDI-Tof MS (VOYAGEUR CONTROL PANEL program) and peptides were submitted to fingerprinting analysis.
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com