Sentence examples for facile sample preparation from inspiring English sources

In contrast to the conventional studies of bacteria in a stationary fluid, this work demonstrates continuous label-free trapping and alignment of biological entities in flowing fluids in a simple microchannel with low cost microfluidic chip fabrication, facile sample preparation and remote isothermal control of trapping by small uniform magnetic fields.

Genetically encoded probes are usually preferred due to availability of higher labeling density than antibody-based staining, and allows more facile sample preparation like the chromosome preparation method employed in this study.

Thus, the development of a facile sample preparation for the analysis of the biomolecules using the whole-body IMS of C. elegans has been desired.

Also, to enhance the solubility for facile purification of GIG47 and for sample preparation for NMR measurements we added his-tags to both N- and C- termini with the sequences of MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMASGG and GGGLEHHHHHH, respectively.

Hence, use of LC-MS/MS for analyzing steroids is a feasible approach as the sample preparation step involved is facile, economical and does not require any additional derivatization step.

SAM method has been proved to be a facile and effective way to form well-defined and controlled films for AFM sample preparation [20, 21].

Sample Preparation.

Standard and Sample Preparation.

a) Standard and Sample Preparation  .

XB performed the sample preparation.

No additional sample preparation was required.