Sentence examples for evaluation of the initial from inspiring English sources

The risk factors were evaluated by the in-depth evaluation of the initial electronic patient notes recorded by the ED physician or physician assistant including vital signs and laboratory findings.

In this regard, a detailed method for evaluation of the initial cost was introduced.

Then, a modified airframe is developed based on evaluation of the initial airframe.

Evaluation of the initial hydrocarbon and average reservoir pressure are typical findings of such methods.

Completeness, correctness and quality measures are computed for evaluation of the initial and the resulted updated maps.

A statistical approach was applied to estimate knee points as the quantitative evaluation of the initial fracture.

For the re-evaluation of the initial PHI-BLAST pattern, we generated a tCWCH2 consensus sequence of "LVCKWDGCSEKLFDSPEELVDHVCEDHVGTQLEYTCLWKGCDRFPFKSRYKLIRHIRSHTGEKP".

If all trials showed similar patterns based on visual evaluation of the plots, the initial trial was selected.

An evaluation was undertaken of the initial 6 years of the Active Living Research ALRR) program.

These errors could have been avoided, for the most part, by the evaluation of the patient's initial presentation.

A second component consists of a qualitative process evaluation exploring the initial experience of pregnancy following repeated miscarriages.