Sentence examples for evaluated the potency and from inspiring English sources

To design potent, safe and selective inhibitors of furin, we evaluated the potency and selectivity of the derivatized peptidic inhibitors modeled from the extended furin cleavage sequence of avian influenza A H5N1.

To evaluate the potency and duration of three subparalyzing doses of vecuronium (VEC) in isoflurane-anesthetized horses.

Therefore, the development of a noninvasive and high-throughput analytical method is needed for evaluating the potency and efficacy of drugs in vitro during the early stages of drug discovery.

To evaluate the potency and selectivity of BU-32 for the three proteasome catalytic active sites, we monitored the rates of fluorogenic peptide substrate hydrolysis by the proteasome in intact cells.

Using the same tests performed to evaluate the tumoricidal activity of magainin II, Lehmann and his colleagues evaluated the potency of cecropin A (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2) and cecropin B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2) against bladder cancer cells [ 23].

In studies described in the 15 September 2005 issue of The Journal of Immunology, they evaluated the potency of three community-acquired MRSA strains (MW2, LAC, and MnCop) and two hospital-acquired strains (MRSA252 and COL).

Yang et al evaluated the potency of Quxie Capsule on the median survival time and quality of life in patients with advanced CRC [ 50 ].

We have evaluated the potency of the multivalent peptide in terms of stabilization of HIF-1α and the downstream effect.

First, we evaluated the potency of individual replicon DNA or particle vaccine against TeNT, which induced strong antibody and protective responses in BALB/c mice following 2 or 3 immunizations.

To address this issue, we systematically evaluated the potency of the PCAIN approach for homology-based structure prediction, motivated by the high fold-specificity of PCAINs.

Finally, we evaluated the potency of the novel ChpPV NS1 protein in inducing apoptosis in B19V semi-permissive UT7/Epo-S1 cells [15].