Sentence examples for construct a profile based from inspiring English sources

But at least one group has tried to construct a profile based on scientific methods, and its conclusions are the ones most likely to affect American policy.

No researcher has yet been able to construct a single profile based on simple socioeconomic indicators that would accurately describe the "typical" jihadist.

HMMER v3.0 (Eddy, 2011) was used to construct HMM profiles based on a multiple sequence alignment of Orco sequences of D. melanogaster, Apis mellifera, Tribolium castaneum, and Manduca sexta resulting in three local HMM (83bDom_1: VKHQGLVADLMPNIRLMQMVGHFMFNYYS, 83bDom_4: TVEIPRLMIKSWYPWDAMHGM, 83bDom_5: DVMFCSWLLFACEQLQHLKAIMKPLMELSASLDTYRPNS) profiles and a global HMM profile.

In contrast, genes that do not belong to any of the three patterns of interest (i.e. noise) were simulated by constructing expression profiles based on a Poisson distribution with random λ, obtained from a uniform distribution [1, 300].

On the other hand, Sugiyama et al. [70] experiments with a collaborative approach constructing user profiles based on collaborative filtering to adapt search results according to each user's information need.

When constructing a profile on Facebook, most people choose to present an idealised version of themselves.

The resultswere "inconclusive" and not forensically reliable, but he did construct a partial profile and based on this analysis, he said, "it's possible the Ripper could be female".

And the simplest way to do that seems obvious: construct a hierarchy based on overall similarities.

EST-SSR profiles obtained on 40 pigeonpea genotypes were used to compute pair-wise genetic distances among different genotypes to construct a dendrogram based on UPGMA clustering.

Zheng et al. constructed Phylogenetic profiles based upon the presence or absence of neighboring protein pairs within a genome [ 16].

If we could construct a drinking game based around Edith Bowman and the word "Amazing" tomorrow.