Sentence examples for consensus was generated from inspiring English sources

For each family, sequences were retrieved with VMATCHSELECT and a consensus was generated from a MUSCLE 3.7 (Edgar 2004) alignment.

If any of the identified sequences extended the ends of the EST a new consensus was generated for the EST.

Firstly, the majority consensus was generated by counting the nucleotide frequency at each position of the repeat alignment.

Metrics to be included were also reviewed by our department education committee and a consensus was generated regarding each item.

For each of these methods, a prediction score was obtained for all residues in the death domain of IRAK-M and a consensus was generated from the different methods applied, taking into account the accessibility of the residue.

This consensus was generated by the COBBLER program (COnsensus Biasing By Locally Embedding Residues, http://blocks.fhcrc.org/blocks/cobbler.html) from all identified MADS-box amino acid sequences "MGRKKIEIKRIENKTNRQVTFSKRRNGLFKKAHELSVLCDAEV ALIVFSPSGrlyeyannni" [ 30].

A consensus is generated for all the reads in each cluster based on the alignments of these reads to the reference genome.

To specify the conservation status of individual positions, usually a majority rule consensus is generated across the taxa investigated, e.g. a character that is G in 80 out of 100 taxa is termed '80% conserved' [ 4, 16, 52].

Multiple primers selected at random locations across the consensus were generated for each sequence using the Primer3 [ 96] plug-in in Geneious® 6.1.8 (Biomatters Ltd., New Zealand) and tested with cDNA derived from different Symbiodinium ITS2 types (Additional file 9).

Contig validation procedure is presented in Additional file 1: Algorithm 3. First, for each contig C, a consensus is generated and is compared against every constituent read r. r is retained only if the edit distance between r and the consensus is within d.

In both analyses, a bootstrap consensus tree was generated from the 100 resulting consensus trees using the CONSENSE program of the PHYLIP package.