consensus is generated

USAGE SUMMARY

The phrase "consensus is generated" is correct and usable in written English.
It can be used when discussing the process of reaching an agreement or collective opinion among a group of people. Example: "Through extensive discussions and negotiations, a consensus is generated among the stakeholders regarding the project's direction."

✓ Grammatically correct

Science

Human-verified examples from authoritative sources

Exact Expressions

3 human-written examples

A consensus is generated for all the reads in each cluster based on the alignments of these reads to the reference genome.

BMC Genomics

To specify the conservation status of individual positions, usually a majority rule consensus is generated across the taxa investigated, e.g. a character that is G in 80 out of 100 taxa is termed '80% conserved' [ 4, 16, 52].

BMC Evolutionary Biology

Contig validation procedure is presented in Additional file 1: Algorithm 3. First, for each contig C, a consensus is generated and is compared against every constituent read r. r is retained only if the edit distance between r and the consensus is within d.

BMC Genomics

Human-verified similar examples from authoritative sources

Similar Expressions

57 human-written examples

For each family, sequences were retrieved with VMATCHSELECT and a consensus was generated from a MUSCLE 3.7 (Edgar 2004) alignment.

Genome Biology and Evolution

Metrics to be included were also reviewed by our department education committee and a consensus was generated regarding each item.

BMC Medical Education

If any of the identified sequences extended the ends of the EST a new consensus was generated for the EST.

BMC Genomics

Firstly, the majority consensus was generated by counting the nucleotide frequency at each position of the repeat alignment.

BMC Genomics

This consensus was generated by the COBBLER program (COnsensus Biasing By Locally Embedding Residues, http://blocks.fhcrc.org/blocks/cobbler.html) from all identified MADS-box amino acid sequences "MGRKKIEIKRIENKTNRQVTFSKRRNGLFKKAHELSVLCDAEV ALIVFSPSGrlyeyannni" [ 30].

BMC Plant Biology

For each of these methods, a prediction score was obtained for all residues in the death domain of IRAK-M and a consensus was generated from the different methods applied, taking into account the accessibility of the residue.

Cell Communication and Signaling

Multiple primers selected at random locations across the consensus were generated for each sequence using the Primer3 [ 96] plug-in in Geneious® 6.1.8 (Biomatters Ltd., New Zealand) and tested with cDNA derived from different Symbiodinium ITS2 types (Additional file 9).

BMC Evolutionary Biology

Whenever multiple PFMs are available for one TF a consensus PFM is generated.

Plosone

Expert writing Tips

Best practice

Use "consensus is generated" when you want to emphasize the active process of creating agreement, often through discussion and iteration.

Common error

Avoid overusing passive voice constructions like "consensus is generated" if an active voice alternative is clearer and more direct. Consider who or what is generating the consensus and make it the subject of your sentence.

Linguistic Context

The phrase "consensus is generated" functions as a passive construction, indicating that a consensus is the result of an action. Ludwig AI confirms its usability in English, particularly in contexts where the emphasis is on the formation process rather than the actor.

Expression frequency: Uncommon

Frequent in

Science

100%

News & Media

0%

Formal & Business

0%

Less common in

Academia

0%

Encyclopedias

0%

Wiki

0%

Ludwig's WRAP-UP

The phrase "consensus is generated" is a grammatically correct passive construction commonly used to describe how agreement is reached, particularly in formal and scientific writing. As Ludwig AI confirms, it emphasizes the process of forming a consensus rather than focusing on who is creating it. While it's valuable for highlighting the development of shared understanding, be mindful of passive voice overuse and consider active voice alternatives for clarity. Key sources include scientific publications where precision and objectivity are paramount.

More alternative expressions

Phrases that express similar concepts, ordered by semantic similarity:

agreement is reached

This phrase focuses on the outcome of the process, which is achieving an agreement.

a collective decision is made

This alternative highlights the action of deciding together, implying a formal decision-making process.

a consensus emerges

This alternative emphasizes the gradual development of agreement rather than the act of creating it.

the group comes to an agreement

Focuses on group dynamics to reach agreement, in a less formal way.

a common view is formed

This alternative highlights the formation of a shared perspective among a group.

an accord is reached

Emphasizes formal and diplomatic approach to reach agreement.

a unified position is established

This phrase suggests a more formal and deliberate process of creating agreement.

a unified stance is adopted

This suggests a group or entity publicly declaring a shared position.

a shared understanding is developed

This emphasizes the cognitive aspect of reaching a consensus, focusing on mutual comprehension.

a settlement is achieved

This phrase implies resolving differences to arrive at a mutually acceptable conclusion.

FAQs

How can I rephrase "consensus is generated" to sound more active?

You can use phrases like "stakeholders reach a "consensus"", "the team develops a "consensus"", or "participants form a "consensus"" to emphasize the actors involved.

Is it better to say "consensus is generated" or "consensus is reached"?

Both are correct, but "consensus is reached" focuses on the outcome, while "consensus is generated" emphasizes the process of creating that agreement.

In what contexts is "consensus is generated" most appropriate?

"Consensus is generated" is often used in formal and scientific writing where the process of reaching agreement is as important as the agreement itself. It shows the result of a deliberative process.

What are some synonyms for "generated" in the context of "consensus is generated"?

You could use words like "formed", "developed", "created", or "established" to replace "generated", depending on the nuance you want to convey.