Sentence examples for consensus bias from inspiring English sources

These assumptions are often referred to as projection bias or false consensus bias.

When President Obama challenged the small group of Republicans to put up a clean bill for a vote, blinded by false consensus bias, they refused claiming there would not be enough votes to end the shutdown.

The consensus sequences were generated by the COBBLER (Consensus Biasing By Locally Embedding Residues) program [36].

To calculate consensus sequences, the COnsensus Biasing By Locally Embedding Residues method was applied (COBBLER).

An embedded consensus sequence for each of the GST classes was generated using COBBLER (COnsensus Biasing By Locally Embedding Residues [ 54]).

This consensus was generated by the COBBLER program (COnsensus Biasing By Locally Embedding Residues, http://blocks.fhcrc.org/blocks/cobbler.html) from all identified MADS-box amino acid sequences "MGRKKIEIKRIENKTNRQVTFSKRRNGLFKKAHELSVLCDAEV ALIVFSPSGrlyeyannni" [ 30].

A genefinder, for instance, ought to combine splice-site consensus, codon bias, exon/ intron length preferences and open reading frame analysis into one scoring system.

<><><><> OO Few Meteorologists Agree With 97 Percent Global Warming Scientific Consensus says a new study, due to a combination of factors: lack of awareness of the expert consensus, political bias, and lack of climate expertise, which differs fundamentally from weather.

Nearly 70 years ago, cognitive psychologists identified a phenomenon called the False-Consensus Bias, which leads people to assume everyone thinks in the same way, that there is a general consensus regarding beliefs and values.

Indeed, simply taking the K t values of SGLT1 and GLUT2 to be the same as each other and much lower than the literature consensus strongly biases simulation outcome.

To estimate work group consensus and negate bias, the authors used latent class analysis.