Sentence examples for chemistries on an from inspiring English sources

Plasmid DNA was prepared using the Qiagen plasmid mini kit (Qiagen, Inc .. Recombinant clones were sequenced using BigDye (ABI) and DYEnamic ET (Amersham) chemistries on an ABI Prism (model 310 or 3100) instrument and the appropriate commercial or custom-designed primers.

The entire OPA1-coding region and flanking exon intron boundaries were amplified by the polymerase chain reaction (PCR) and sequenced with BigDyeTM terminator cycle chemistries on an appropriate genetic analyser (Primers and cycling conditions are available on request).

RNase H activity is supported by DNA-like AO chemistries on a phosphorothioate backbone [18].

The agonists were linked using orthogonal coupling chemistries on a tri-functional small molecule core.

After hydroxyapatite normalization, cDNA was coligated, nebulized, and sequenced three times on a GS FLX instrument using titanium chemistry on a one-sixteenth plate, a one-fourth plate, and a full picotiter plate, respectively.

As science journalist Peter Brannen points out, life is extremely fragile, a "thin glaze of interesting chemistry on an otherwise unremarkable, cooling ball of stone".

"Goodie Bags", as they are known, are an integral part of 3.091, an MIT GIR that explores chemistry on an electronic and atomic level.

Nucleotide sequences were obtained using Big Dye version 1.1 chemistry on an ABI 3730XL apparatus.

Mouse Aβ1-42, DAEFGLMVGGVVIAQKLVFFAEDVGSNKGAII GLMVGGVVIA was synthesized using Fmoc chemistry on an automated peptide synthesizer (model PS3, Protein Technologies, USA).

Following an Exonuclease I digestion [17], the amplicons were sequenced with BigDye terminator chemistry on an ABI 3730 capillary sequencer (PE Applied Biosystems, Foster City, California).

The synthesis of carboxyfluoresceinated Penetratin (CF-RQIKIWFQNRRMKWKK) was performed by solid-phase Fastmoc chemistry on an Applied Biosystems 433A automated peptide synthesizer as described in Bruston et al. [33].