Your English writing platform
Discover LudwigSuggestions(5)
Exact(10)
In drug design, for example, the function of a protein is determined by sequence comparison and 3D modelling programs.
By sequence comparison and signal peptide prediction, the precursor was predicted to release a 55-amino acid mature peptide with amino acid sequence, IRCPKDKIYKFCGSPCPPSCKDLTPNCIAVCKKGCFCRDGTVDNNHGKCVKKENC.
The secondary structure in vivo was deduced by sequence comparison and confirmed by the crystal structure (22, 45, 46).
PPR genes are discounted due to the difficulty in concretely matching PPRs by sequence comparison, and also because of the variability in number and location of PPR genes.
By sequence comparison and signature motif searches, putative orthologue of MAPK cascade members have been identified in rice, Medicago sativa, Zea mays, tobacco and tomato.
The Arabidopsis δOAT gene (At5g46180) was identified by sequence comparison and was found to be upregulated in young seedlings and in response to salt stress [ 20].
Similar(49)
Extensive studies of potyvirus sequences have shown that potyvirus species can be distinguished by sequence comparisons, and the process of recognising a species is now in large part determined using this measure.
The identity of each of these pig defensins was ascertained by sequence comparisons and cysteine positions and spacing.
We showed, by sequence comparisons and phylogenetic analyses, that this variation resulted from the duplication of the second TIR-220 copy present in one of the alleles.
We did so by sequence comparisons and by reconstructing the complete collection of phylogenetic trees of each P. digitatum protein and their homologs in other species (i.e. a phylome).
The comparison of CTCF and CP190 profiles suggests that each boundary may be distinctive, which is borne out by sequence comparisons and swapping experiments from other labs, but this is no reason to suggest that the components of any boundary vary from one parasegment to another.
More suggestions(15)
by sequence variation and
by sequence blast and
by sequence loss and
by sequence coverage and
by sequence length and
by sequence optimisation and
by sequence similarity and
by sequence context and
by sequence assessment and
by sequence analysis and
by sequence structure and
by sequence identity and
by synteny comparison and
by sequence homology and
by sequence alignment and
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com