Sentence examples for binding sites we selected from inspiring English sources

Exact(2)

To completely cover these 13 binding sites, we selected 20 individual miRNAs for experimental validation (Supplementary Table 2).

In order to select the most relevant binding sites, we selected peaks with a minimum of two-fold enrichment over IgG control and large area, which correlated with peak height in a linear fashion (Supplementary Figure S1A).

Similar(58)

For the predicted miRNA binding sites, we compared the selected 7-bp motifs with experimentally-verified miRNAs in the miRNA registry [ 9], searching against the complementary sequences of 375 mouse miRNAs.

In order to identify putative NFAT-binding sites (GGAAA), we selected 24 genes for bioinformatic analyses.

To decide a relevant threshold for accepting a predicted binding site, we repeated the analysis in randomly selected regions with the respective PWM.

The continuous stretch of amino acid sequences 26 mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31 mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds.

A total of 3 AR binding sites and 4 ER binding sites were selected for ChIP-qPCR analyses.

The software retrieved human gene promoters for each gene, and the data were filtered in order to extract genes with one or more binding sites for selected homeobox transcription factors.

Potential transcription factor binding sites and miRNA binding sites were selected from all 6- and 7-bp DNA elements, respectively.

Signature sites with different linker sequences between PNA binding sites were selected (Table 1).

Eight gene promoters containing the C1 and P binding sites were selected.

Show more...

Ludwig, your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: