Sentence examples for binding sites was selected from inspiring English sources

The high quality protein model of correct topology and protein-ligand complex active binding sites was selected based on high confidence (C≥−1.5) and binding site (BS≥0.5) cut-off scores.

The continuous stretch of amino acid sequences 26 mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31 mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds.

A total of 3 AR binding sites and 4 ER binding sites were selected for ChIP-qPCR analyses.

Signature sites with different linker sequences between PNA binding sites were selected (Table 1).

Eight gene promoters containing the C1 and P binding sites were selected.

Potential transcription factor binding sites and miRNA binding sites were selected from all 6- and 7-bp DNA elements, respectively.

Transcription factor binding sites were selected as statistically over-represented with a significance level of the corrected P-value < 0.1.

Genes that had an index less than 0.7 and that also contained predicted TDP-43 binding sites were selected.

Interactions between mRNAs and miRNAs in binding sites were selected using Δ G/Δ G m values, allowing us to identify miRNA interactions with near perfect complementarity.

Potential target genes that contain SAFB1 binding sites were selected for further validation using qRT-PCR with TaqMan gene expression assays.

The primer binding sites were selected to ensure optimal amplification under universal conditions and lack of interaction during the ligation and PCR steps.