Sentence examples for binding predictions were selected from inspiring English sources

Similarly, all of the DR binding predictions were selected as supertypes on the basis of predicted binding to multiple DR-alleles (individual predictions not shown).

(3) Subsquently, corresponding RNA-seq-supported C. atys NCBI protein predictions were selected.

Applying these cutoffs to FindMiRNA exon predictions, 5,778 predictions were selected (less than 13% of the total exon predictions) and included in the 'selected predictions' dataset.

From the 14 predictions of Type III, a path of predictions was selected for experimental validation of the approach.

Applying combined filters to our predictions dataset, only about 0.74% of the original FindMiRNA predictions was selected.

The standard application of these binding predictions is to scan sets of proteins or entire genomes for potential binding peptides.

The continuous stretch of amino acid sequences 26 mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31 mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds.

Residues defining the binding sites were selected for site-directed mutagenesis.

Representative structures for each ligand were analyzed and binding modes were selected according to the mutagenesis data.

Neoantigen-binding predictions were made using NetMHCPan38.

The DNA probes were selected by CTCF binding site prediction for each of the 10 genes chosen (Fig. 2B).