Sentence examples for binding detection and an from inspiring English sources

Exact(1)

By using the chimeric phage particle, targeting of αv integrins on cells in culture and tumor-related blood vessels was shown through different applications, including luminescent quantum dots localization, surface plasmon resonance-based binding detection, and an in vivo tumor model.

Similar(59)

The web interface enables binding sites detection, virtual screening hits identification, and drug targets prediction in an interactive manner through a seamless interface to all adapted packages (e.g., Cavity, PocketV.2, PharmMapper, SHAFTS).

Here, we interrogate for the first time the low limits of fragment binding detection using a successfully targeted PPI as a model system.

However, a more general and simpler approach would be to increase the sensitivity of binding detection in a fragment screen.

The instrumental setup described by de Vlieger et al. [ 20] was used for the analysis, with one enzyme binding detection line and the following modifications (cf Fig.  1).

Enzyme binding detection was achieved with a competitive binding assay based on fluorescence enhancement which has a simple principle, is inexpensive, and is easy to interpret.

For this study, we used a modified version of the gp41 MPER peptide to enhance solubitiy and facilitate binding detection (EQELLELDKWASLGGGGSGGWNWFDITKWLWYIKKKKGSKKK).

Hence, the temperatures of the HPLC separation step and the enzyme binding detection were controlled separately.

Post-column, the flow was split 1 9 (Fig.  1, 3), sending 100 μL/min to high-resolution mass spectrometry (HR-MS) detection and 13 μL/min to the enzyme binding detection.

Especially, sensing systems using localized SPR (LSPR) have received significant research attention in recent years as a result of their potential for use as highly sensitive, simple, and label-free bio/chemical binding detection devices [4 6].

High-resolution mass spectrometry gives structural information to identify small molecules while an online enzyme binding detection method provides data on p38α binding.

Show more...

Ludwig, your English writing platform

Write better and faster with AI suggestions while staying true to your unique style.

Student

Used by millions of students, scientific researchers, professional translators and editors from all over the world!

MitStanfordHarvardAustralian Nationa UniversityNanyangOxford

Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak quote

Justyna Jupowicz-Kozak

CEO of Professional Science Editing for Scientists @ prosciediting.com

Get started for free

Unlock your writing potential with Ludwig

Letters

Most frequent sentences: