Sentence examples for binding capability of a from inspiring English sources

The binding capability of a metal on the inhibitors depends strongly on the electronic charge of the active site.

Importantly, only one mutation in the framework may be necessary to recover the binding capability of a humanized antibody.

The maximum binding capability of a ligand depends on the affinity of the cell binding proteins for the ligand, which is understood by saturation kinetics.

We report here the strong binding capability of a peptide named HCL2 (amino acid sequence: ESTYQGH-HTPPVQKGLRYGIILFITSEVFFFAGFF*), a fragment from human mitochondrial protein COX3, with ESAT-6.

The ability to test the binding capability of any coding or non-coding RNA to thousands of proteins simultaneously will significantly improve the pace of mechanistic analyses of RNAs.

In this way, a comprehensive profile can gradually be established for the RNA binding capabilities of a key epigenetic regulator.

In this work we designed fusion proteins that combined the surface adhesion and interfacial activity of a hydrophobin protein together with the high affinity biotin-binding capability of an avidin protein.

To evaluate the metal ion binding capability of this new compound, a colorimetric evaluation was performed in a liquid phase.

After adding a chemiluminescent substrate, binding capability of RelA/p65 was quantified at a luminometer (Labsytems Luminoscan, Helsinki, Finland).

As far as P. intermedia is concerned, we have evaluated the binding capability of the OMPs, showing that a few proteins interact with sub-fraction #5.

As suggested we now emphasize a relatively weak DNA binding capability of eEF1A1: "Moreover, in vitro binding of recombinant eEF1A1 to a DNA fragment of HSP70 promoter suggests direct and specific, albeit a relatively weak, interaction of eEF1A1 to HSP70 promoter.