Sentence examples for binding capabilities of a from inspiring English sources

In this way, a comprehensive profile can gradually be established for the RNA binding capabilities of a key epigenetic regulator.

The binding capability of a metal on the inhibitors depends strongly on the electronic charge of the active site.

Importantly, only one mutation in the framework may be necessary to recover the binding capability of a humanized antibody.

The maximum binding capability of a ligand depends on the affinity of the cell binding proteins for the ligand, which is understood by saturation kinetics.

We report here the strong binding capability of a peptide named HCL2 (amino acid sequence: ESTYQGH-HTPPVQKGLRYGIILFITSEVFFFAGFF*), a fragment from human mitochondrial protein COX3, with ESAT-6.

Most strikingly, outside of promoters and CpG islands, p65 binds preferentially to methylated sites; which brings to mind the methyl-DNA binding capabilities of FOXA1, a "pioneer" transcription factor [ 29, 91, 92].

Here, we present a characterization of the metal binding capabilities of YjiA.

By comparing the binding capabilities of many peptide sequences for Aβ(1 40), it was indicated that KLVFF is a minimum sequence for formation of the Aβ aggregate [7], [8].

To assess the PSMA binding capabilities of this first generation IDEPT agent (yCDtriple-F54 pAzF modified by DBCO-PEG4-AH2-TG97 DBCO-PEG4-AH2-TG97 DBCO-PEG4-AH2-TG97 DBCO-PEG4-AH2-TG97ified from LNCan cells.

The design of selective inhibitors is hindered due to the broad substrate binding capabilities of the GST enzymes.

The binding capabilities of cys-anxA5 constructs were analysed via competition measurements between active anxA5-DTPA 6 and anxA5-FITC, inactive M123-anxA5-DTPA M123-anxA5-DTPA M123-anxA5-DTPAype andA5 and anxanxA5-FITCr binding to apoptotic Jurkat T cells.