Your English writing platform
Discover LudwigSuggestions(5)
Exact(2)
The difference between the initial (pHi) and at equilibrium (pHe) pH values was plotted vs. pHi.
The difference between the initial pHi and pHf values were plotted against pHi, the point of intersection of the resulting curve with abscissa, at which (pHi − pHf) = 0, gave the pHpzc.
Similar(58)
The initial PHI-BLAST pattern recovered 90% (572/637) of the collected sequences (Additional file 3).
bTaxa with bit score ≥ 90 in the initial PHI-Blast (see Methods section) are listed here.
For the re-evaluation of the initial PHI-BLAST pattern, we generated a tCWCH2 consensus sequence of "LVCKWDGCSEKLFDSPEELVDHVCEDHVGTQLEYTCLWKGCDRFPFKSRYKLIRHIRSHTGEKP".
The change in pH (pHf − pHi) was plotted versus initial pHi and the point where the graph intersect the X-axis was reported as the pHpzc.
The initial pH (pHi) in each flask was adjusted between 3 and 11 by adding NaOH or HCl solutions (0.1 M).
50 mL DDW was transferred to a series of conical flasks and the initial pH (pHi) of these solutions were roughly adjusted between 1 and 10 using either 0.1 M HCl or 0.1 M NaOH solution.
The initial pH (pHi) of these solutions was accurately noted.
(3) The initial condition function (phi(t)) denotes a continuous vector-valued initial function of (t in[-tau_{max},0]).
The initial rate of pHi recovery is expressed as H+ efflux calculated from the gradient of the first 30 s of recovery [18].
More suggestions(11)
between the initial examination
between the initial level
between the initial concentration
between the initial contact
between the initial visit
between the initial measurement
between the initial rate
between the initial state
between the initial response
between the initial model
between the initial amount
Write better and faster with AI suggestions while staying true to your unique style.
Since I tried Ludwig back in 2017, I have been constantly using it in both editing and translation. Ever since, I suggest it to my translators at ProSciEditing.

Justyna Jupowicz-Kozak
CEO of Professional Science Editing for Scientists @ prosciediting.com