Sentence examples for at the contained from inspiring English sources

Animals were captive bred for research purposes and housed in the Astrid Fagraeus laboratory at the contained experimental facilities at the Biomedical Primate Research Centre.

The new building, Sibley Hall, was completed in July 1857, and at the time contained the entire school.

(a) shows ADC outputs at the receiver contained in the payload segment.

The toolbar at the right contains the following tools: Zoom - zoom in on the photo.

Within treated populations, the nucleosome at the TSS contained both acetylated and/or tri-methylated H3K27.

The units that shot at the marchers contained both French and Moslem troops.

I had to get used to the rural culture, which at the time contained biases I didn't share.

A transcript on file at the museum contains the rest of the conversation.

LL-37 was prepared by the core peptide facility at the University of Utah, containing the amino acid sequence: [LL-37, 37 aa]

Some pills, a government official said at the time, contained cement powder.

Water tested at the end of 2014 contained unacceptable levels of trihalomethanes (TTHM), chemicals that are a byproduct of chlorine.