Sentence examples similar to as priorly underscored from inspiring English sources
As UN Secretary-General Ban Ki-moon recently underscored, intensified global solidarity is needed.
As Anderson underscored, "Cabin air has a particular smell.
Airway mucous load was reduced by the MSCs as priorly reported 25, but bounced back along with inflammation.
"Zero," he said again, as if to underscore the point.
WINE LIST Perfunctory and corporate, as if to underscore the excellence of the traditional cocktails.
Thunder rumbled nearby, as if underscoring the drama.
Other emerging infections, such as monkeypox, underscore the need to remain vigilant against zoonoses.
Of course, the O.C.C. has bigger problems than that — as the hearing implicitly underscored.
As Pérez Laraudogoitia (2005) underscored, this argument is fallacious.
As the previous theme underscored, the consequences of stroke complicated returning to work.
The mutant sequence is as follows, with the variant residues underscored: KPVSLSYRCPCRFFESHVARANV SSL SILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM.
