Sentence examples for alternatively thorough from inspiring English sources
Alternatively, thorough cleaning and disinfection of poultry-house surroundings and manure disposal outside the farm were associated with decreased flock risk.
Alternatively, thorough and highly selective sample preparation and clean up may remove enough chemical background to enable the use of low-resolution MS if high-resolution MS is not available.
Alternatively, a thorough review of multisource cancer registrations, screening coverage and population risk factors in the years immediately prior to and after the change in policy, particularly if compared with other nations of the United Kingdom, may clarify the causative factors responsible for the rise in cervical cancer incidence in young women.
Alternatively, try doing a thorough re-arrangement or cleaning job in your house as it is.
Summarizing, we show a thorough quantification of alternatively spliced AID transcripts and demonstrate that the corresponding protein abundances, especially those of splice variants AID-ivs3 and AID-ΔE4, are not stoichiometrically equivalent.
However, as alternative splicing alters the amino acid sequence of the resulting peptides, and hence, hampers their recognition by AID-FL-specific antibodies, a thorough analysis of alternatively spliced AID variants on the protein level was so far not carried out.
Alternatively, the selected designs can be subjected to more thorough examination techniques such as MD simulations before experimental characterization is attempted [14].
Alternatively there are websites that allow you to play the games on-line directly thorough the PSP's browser.
Although the composition of the dynactin complex in vertebrates gradually became apparent, a thorough analysis of the complex and its subunits in terms of gene duplicates, alternatively spliced isoforms, and phylogenetic evolution is still missing.
Thorough examination of all available mammalian Spire1 isoforms revealed at least 3 alternatively-spliced exons, which we refer to as exons A (majority of KIND domain), B (protein sequence AVRPLSMSHSFDLS), and C (protein sequence VPRITGVWPRTPFRPLFSTIQTASLLSSHPFEAAMFGVAGAMYYLFERAFTSRWKPSK).
